PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P23440_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 182aa    MW: 20907 Da    PI: 8.9417
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P23440_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox628.9e-2052106256
                             T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             rk+ +++ eql  Le+ F+ ++++  ++++eLA++l+L+ rqV vWFqNrRa+ k
  GSMUA_Achr10P23440_001  52 RKKLRLSGEQLALLEDSFRAHSTLAPDQKQELAQRLHLQPRQVEVWFQNRRARTK 106
                             6788899**********************************************98 PP

2HD-ZIP_I/II121.44.5e-3952142191
             HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeL 87 
                             +kk+rls eq++lLE+sF+++++L p++K+ela++L+lqprqv+vWFqnrRARtk+kq+E+d+ +L+r++++l++en+rL++e  e+
  GSMUA_Achr10P23440_001  52 RKKLRLSGEQLALLEDSFRAHSTLAPDQKQELAQRLHLQPRQVEVWFQNRRARTKLKQTEVDCGFLRRCCERLANENRRLKRELMEM 138
                             69************************************************************************************9 PP

             HD-ZIP_I/II  88 reel 91 
                             r+ +
  GSMUA_Achr10P23440_001 139 RSVV 142
                             9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.29748108IPR001356Homeobox domain
SuperFamilySSF466899.41E-1950117IPR009057Homeodomain-like
SMARTSM003891.4E-1750112IPR001356Homeobox domain
CDDcd000862.78E-1452109No hitNo description
Gene3DG3DSA:1.10.10.602.1E-1852106IPR009057Homeodomain-like
PfamPF000465.8E-1752106IPR001356Homeobox domain
PROSITE patternPS00027083106IPR017970Homeobox, conserved site
SMARTSM003401.4E-14108152IPR003106Leucine zipper, homeobox-associated
PfamPF021834.4E-9108140IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MLLIITNCFE EECNVSLSLA IGGVGDLPFI KNLNQTSFKE ETEEKRDGGG TRKKLRLSGE  60
QLALLEDSFR AHSTLAPDQK QELAQRLHLQ PRQVEVWFQN RRARTKLKQT EVDCGFLRRC  120
CERLANENRR LKRELMEMRS VVKPGPQLSV EHRKAARLRM CSSCEKMTSD EKESSLLSTI  180
NS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15056TRKKLRL
2100108RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009380740.11e-123PREDICTED: homeobox-leucine zipper protein HOX17-like isoform X2
SwissprotA2X6743e-46HOX7_ORYSI; Homeobox-leucine zipper protein HOX7
SwissprotQ0E0A63e-46HOX7_ORYSJ; Homeobox-leucine zipper protein HOX7
TrEMBLM0RKR91e-131M0RKR9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P23440_0011e-130(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83153249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-45homeobox protein 2